Sequence for MER0042330

>MER0042330 - Mername-AA223 peptidase [M41.015] peptidase unit: 378-656 ( active site residue(s): 431 metal ligand(s): 430,434,506 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNRKTVFRTLAIVSGILLVIYAFSYFGDDTRGWQSVDTSVALAQLQDKGNIENVQIDDRE       60
61       QQLRIDLKNGNDATKGADRIIAKYPGGSETSAKIFDAVQSSGAPYNTVVKQDSWLAQILL      120
121      FVLPMVILLGLFLFVMARMQGGGRGGMMGFGKSKAKQLSKDMPKTTFADVAGADEAVEEL      180
181      YEIKDFLQNPVRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEM      240
241      FVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDG      300
301      FGDRTGIILIAATNRPDILDPALLRPGRFDRQIPVGNPDLAGRRAILRVHSQGKPISPDA      360
361      DLDGLAKRTVGMSGADLANVINEAALLTARENGAVITGEALEESVDRVIGGPRRKSRIIS      420
421      EHEKKITAYHEGGHTLAAWAMPDIEPVYKVTILARGRTGGHAMTVPEDDKGLMTRSEMIA      480
481      RLVMAMGGRAAEELVFHEPTTGASSDIDQATKIARAMVTEYGMSARLGAVRYGQEQGDPF      540
541      LGRSMGMASDYSHEVAREIDEEVRNLIEAAHTEAWAILNEYRDVLDDLATALLERETLHR      600
601      KDLEQILASVTKRPRITAFNDFGERIPSDKPPVKTPGELAAERGEPWPPEQPAEPAVPVA      660
661      AQQQREPVPANGYPQQGYQAQPQYAYPHQQGGGYPSPHAPTQAYPRQGGTHGSRPDYGAP      720
721      AGWSAPGWPPRDEAPQQPGAQPGYGGWGRPAEQPQPGGFQPWGDPQHSGRGEDPAHPGSR      780
781      GEDDDNRDWDGPNGRN                                                  796