Sequence for MER0042299

>MER0042299 - urease [M38.982] peptidase unit: 4-573 ( active site residue(s): 367 metal ligand(s): 141,143,224,279,327 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTELSRARYAELFGPTTGDRIRLADTDLLIEITEDRSGGPGLAGDEAVFGGGKVLRESMG       60
61       QSRATRADGAPDTVITGAVIVDHWGIVKADIGIRDGRICGIGKAGNPDTMSGVHPDLVVG      120
121      PSTEIIAGNGRILTAGAIDCHVHFICPQLMDEALGGGITTLIGGGTGPAEGSKATTVTPG      180
181      AWHLARMLEATDHWPLNIALLGKGNTVSEAAMWEQLRAGASGFKLHEDWGSTPAAIDACL      240
241      RVADASGVQVALHSDTLNEAGFVEDTLAAIAGRGIHAYHTEGAGGGHAPDIITVAAHPNV      300
301      LPSSTNPTRPHTVNTLDEHLDMLMVCHHLSPSIPEDLAFAESRIRPSTIAAEDLLHDLGA      360
361      ISMIGSDSQAMGRIGEVVMRTWQTAHVMKRRRGALPGDGAADNARVRRYIAKYTICPAVA      420
421      HGLDAEIGSVEVGKLADLVLWDPAFFGVRPHAVLKGGAIAWAAMGDANASIPTPQPVLPR      480
481      PMFGAAAPVAAATSLHFVSEHALADGLAERLAVRRKLVAVKDVRRLTKTDMPLNDAMPRI      540
541      EVDPDTFTVRVDGEVWAEQPATELPMAQRYFLF                                 573