Sequence for MER0042288

>MER0042288 - family M38 non-peptidase homologues [M38.UNW] peptidase unit: 4-381 ( active site residue(s): 301 metal ligand(s): 57,59,172,229,259 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGLLIKGAVLYGEGEPVDVFVDEGEIRQIGTDLGVVDAEIVEARGQVLLPGFVDLHTHL       60
61       REPGREDTETIETGSAAAALGGYTAVFAMANTNPVADSVVVTDHVWRRGQEVGLVDVHPV      120
121      GAVTVGLAGKQLAEMGTMAAGVGGVRMFSDDGHCVYDPLIMRRALEYSNSLGVLIAQHAE      180
181      EPRLTKGAVAHEGPTAARLGLAGWPRAAEESIVARDALLARDAGARVHICHASTAGTVEL      240
241      VKWAKAQGISITAEVTPHHLLLDDSRLETYDAVNKVNPPLREASDTAALRAALAEGIIDC      300
301      VATDHAPHAEQDKCCEFAAARPGMLGLETALSIVVETMVRPGLLDWRGVARVMSERPAEI      360
361      VGLDDQGRPIAVGEPANLVLVDPDATWTVRASELASISNNTPFEEMTFPARVTMTLLRGR      420
421      ITARAGRAAQPQGAGGA                                                 437