Sequence for MER0042240

>MER0042240 - methionyl aminopeptidase 1 ({Escherichia}-type) [M24.001] peptidase unit: 39-287 ( active site residue(s): 116 metal ligand(s): 133,144,207,240,271 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVRTRQPLVPGTPTPIREVPRSIERPEYAWKKTAKEGSEPWVQTPETIEKMRIACRIAA       60
61       QALEEAGKAVAPGVTTDELDRIAHEYMCDHGAYPSTLGYKGFPKSCCTSLNEVICHGIPD      120
121      STVIQDGDIVNIDVTAYIHGVHGDTNKTFLAGDVDEEVRLLVERTEEATNRAIKAVRPGR      180
181      ALNVIGRVIEAYANRFGYGVVRDFTGHGVGPTFHNGLVILHYDQPAVETVIEPGMTFTIE      240
241      PMINLGGIDYEIWDDGWTVVTKDRKWTAQFEHTLVVTETGAEVLTLP                   287