Sequence for MER0042239

>MER0042239 - subfamily M24A unassigned peptidases [M24.UPA] peptidase unit: 1-256 ( active site residue(s): 83 metal ligand(s): 100,111,174,207,239 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVELKTPAEIERMRVTGAFVADVLADLRARAQVGVNLLDLEAHVRERIRQRGAVSCYWDY       60
61       APSFGRGPFRNTVCLSVNDAVLHGMPFDYRLRDGDVLSMDLAVSIDGWVADAAVTVIVGT      120
121      ARAEDQRLVRATEDALAAAIEAAVPGNRLGDISAAIAAVASAYGYPVNTEFGGHGLGRTM      180
181      HEDPHVANVGRPGRGMTLRPGLTLALEPWFARTTDRIYIDDADGWTVRSADGSRTAHSEH      240
241      TVAITADGPLVLTRAA                                                  256