Sequence for MER0042238

>MER0042238 - subfamily M24A unassigned peptidases [M24.UPA] peptidase unit: 9-266 ( active site residue(s): 86 metal ligand(s): 104,115,184,217,248 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVFGRKNKKVVPFRTAGELDAMAAAGAVVGRALVAVRAAAKPGVSTLELDEVAEQTIREA       60
61       GAVPSFKGYHGFPGSICSSVNDRVVHGIPSAEEILAEGDLVSIDCGAILDGWHGDSAWTF      120
121      GVGSIIEADRLLSEATRISMEAGIAAMVPGNRLTDVSHAIELGTRAAEQEHGRAYGIVDG      180
181      YGGHGIGREMHMDPFLANEGEPGRGPQLVVGSVLAIEPMLTLGTTQTKVLDDDWTVVTVD      240
241      GSRAAHWEHTVAVTEDGPRILTPRPE                                        266