Sequence for MER0042188

>MER0042188 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 318-484 ( active site residue(s): 459 metal ligand(s): 380,384,461 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNHRSTLAPGHRPRTGHRYRDDDQPFAPATESYAESSYTESSYAESGYRFAAPAAAATAA       60
61       GFGAQVEPEPHAAWHDGSAWTARDEQAAWNQGDWHQGEQPAWSQNDRAAWHQQEWDQQSA      120
121      WTEQDSWSRQDSWNQQASWSDGDAWGGEPTRSAVGATIADATAATESDPSQWQGACDNNA      180
181      WAQQPAQWTPGSEEPWTGNDWSGEPADEWTGDRDQRWTADDEADVAWDEPESPAAPAVIP      240
241      ARAGSRRGGAHRMPAPPTALKGRAAVVAVAAGAVVAAGQAAMASPQQPSQTIDYEAAGQI      300
301      HEIAAQSMSLEDPTASPDSPQVLNVSSPANIGQFGDMLEKGRKYAEELAAAEAAKLRPLF      360
361      AKFAAGNFTSGFGARWGVQHLGIDVAAPIGTPIYAVADGTVIEAGPASGFGMWVRLLHDD      420
421      GTVTVYGHIDTATVSAGERVLAGDQIATVGNRGFSTGPHVHFEVWLNGSDKVDPVPWLAT      480
481      RGISLGPQRD                                                        490