Sequence for MER0042187

>MER0042187 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 93-219 ( active site residue(s): 196,461,515 metal ligand(s): 111,115,198 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MVAVSARGVLWFALGTVVGLIALVLVVVLPSVEDPCEGSSLLGGGPSALPPLGGYPAGDP       60
61       RAADPSPAQANPILTATPSLAAGAGPIRRTLPMAVGTFTISDVFGSRGGGHKGVDMAAAD      120
121      GTPIFSVSDGRVVAAGPASGFGNWIVVDSVDVNGRSYSAVYGHMWDHGVLVRAGDTVRAG      180
181      QQIGAVGSAGESSGPHLHFEIVPGGRFTGGRQIDPMPWLDGAPTPDLGGAQWYSADPRCS      240
241      LGFGSPGGALAPGKVPPELEVWYRRAGSLCPEITPSLLAAQGRQESGFRRGATSPAGAQG      300
301      LAQFLPGTAASASPIDGRPYVLDADGNGAASVWDDGDAIMGQGRYMCSLAAKIRQWQAEG      360
361      RVQGDVTALALAAYNAGEGAVLASGGMPNQYAAHYSETRPYVANILAMEPQYRAPGSLGR      420
421      FTPEEGERGPQILEAAHEWLGTPYVWGGGGPQGPSNGGMDGPGLTAAAVFAASGGEVMLP      480
481      RTAEQQWEFGEEVSMGKAQPGDLVFSDFGPRGPARVGVYAGEGRMIQSAPAGQDSRAGGV      540
541      SEIPVPGDARVRRVL                                                   555