Sequence for MER0042186

>MER0042186 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 58-224 ( active site residue(s): 199 metal ligand(s): 120,124,201 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPVTDPLSFLRPGAPRSRRRRVAGRAVALSAALGVSFGVFAAADPADGTASATAAVADAT       60
61       EETVQFTAFTPREAQMPQIVPEPVLWEQHRLAVEAARPKTVRPVAGVLTSHFGARWGAQH      120
121      NGLDFGDPIGAPIAAVTDGVVIEAGPASGFGLWVRVQQDDGTVGVYGHVNDILATVGQQV      180
181      RAGDVIATVGNRGYSTGPHLHYEVHAPGVGPIDPAPWLAARGVDVFAPSH                230