Sequence for MER0042185

>MER0042185 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 78-244 ( active site residue(s): 219 metal ligand(s): 140,144,221 ) (Nocardia farcinica) (Source: MEROPS) 
1        MRAAASAAVAAGALVGVAAQVAPALAAASPLAPSRNTEAAEETIAFKGTAEIPAAEAKQI       60
61       AEPAPAADPAPVTQVAAPVAQNVAQQPFGIPNLPPEIAAPLAQVEDVLKNVQQHVAPPVA      120
121      VRPVAGAISSGYGTRWGQFHYGLDFADALGAPIRSVSSGTVIEAGPASGFGLWVRVLQDD      180
181      GTTAVYGHVNDMYVQAGQRVNAGDVIATVGNRGQSTGPHLHLEIWDQGGNKIDPMPYLAA      240
241      KGVPMHWGPSAH                                                      252