Sequence for MER0042184

>MER0042184 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 160-325 ( active site residue(s): 301 metal ligand(s): 222,226,303 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVGVMLDKARRAGLDRVREAGGIVVVPPDWRTRARPRTTAAGRDLTALWRRARREARALR       60
61       RGPRPDPRRWWTEQKKAEYRALLRTHKWLIAGLAAVLLVAAADGVASRPGTGPLGPNEAQ      120
121      RVFFAHPQQFQSTPPSVRRYLNAIANGERLREQAVVAAAARATLERAKAEAAAAAAGEWQ      180
181      PWINEPGTVIVPGSVIPDISGFVLPARGMFTSGFGSRWGTFHNGIDVAGPIGTPIYAVAA      240
241      GTVIDAGPAQGFGLWVRIRHDDGAITVYGHMYDFFVSVGERVPAGMQIARMGNRGDSTGP      300
301      HLHFEVIVNGRHVDPRAWLAARGLSY                                        326