Sequence for MER0041995

>MER0041995 - peptidyl-dipeptidase Dcp [M03.005] peptidase unit: 2-676 ( active site residue(s): 466 metal ligand(s): 465,469,494 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNPFFERSALPYELPPFARIREEHFLPAFERGMREQLAEVAAIAGDAQAPTFANTVVALE       60
61       RSGAVLRRVRAVFFALVSADSTPGIQAIEAEVSPRLAAHHDAIHLNAELFARIDALYERR      120
121      AELGLDAQDLRLLEQYHLEFVRAGARLDAAGQARLRELNAELAAAATRFGQNLLAATNAA      180
181      TVLVEHERELAGLAPDAVAAAAEQARALGHEGWALRLQNVSNQPVLAELSDRELRRRVLD      240
241      ASLERGFGTDPDNAATAVRIAALRAERAALLGFPDHAGYVVADQTASTAEAVEEMFARLV      300
301      PPAVANAEREAAELAAAMRAAGAGDELRAWDWLYWSERVRAERFAVDGAALRPYLELERV      360
361      LWDGVFHAAERVYGITVRERADLTGYHPDVRVFEVFDADGSPLGLFLGDYFARPSKRGGA      420
421      WMTALVDQSTLLGTRPVVTNVLNIARPPEGEPVLLTWDNVRTLFHEFGHALHGLCSDVRY      480
481      PYFSGTAVPRDFVEFPSQVNEMWMDHPEILARYARHVETGAPMPPELVERLREAARFGEG      540
541      FRTVEYLAAAQLDWAWHRVADPAALDGVDAAAFEEQALRKAGLALSAVPPRYRTAYFAHI      600
601      FSGGYAAGYYSYIWSEVLDADTVEWFTDGAAPIRDKGEIFRRTLLARGGSVDPMAAFAQV      660
661      RGREPDIGPLLARRGLSRT                                               679