Sequence for MER0041957

>MER0041957 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 2-263 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCRLFGLSAAPERVHATFWLLEAPDSLAEQSRREPDGTGLGVFDEHGAPVVRKQPIAAYR       60
61       DAAFGREAQEFVSQTFLAHIRYASTGGLSAVNTHPFTQHGRLFAHNGVLGDLERLDAELG      120
121      EYRALVAGDTDSERLFALITMQIDAHDGDVGAGIAAATRWVAVTLPVFAINLVLITATEL      180
181      WALRYPDTHDLFVLRRSAGGRHGRHLEHSGSAGRMRARSGPLARYPAVVVASERMDEDPG      240
241      WENLPVGELLRVGADQAVTRHRILDRPPRHRLTLRDLDPHAAASQSPS                  288