Sequence for MER0041925

>MER0041925 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 2-121 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCRHLGYVGAPVAVGELLTRGTHSLREQSWAPREMRGGGTINADGFGAAWWRPATDGVAV       60
61       SRYRNREPIWSDPAVTEVLGQLVSPAVLGSVRSATVGMPIERSACAPFTTGRWAFSHNGV      120
121      VPRWRQVLSAVSADLDVAATRSGATRLFETARLLDAEAATDAATLWVLLADLIASAESGG      180
181      YGDDPETAVRLLVEAVLRHEPAARLNFLLCDGTRLLATTVYHSLSALVTDEFAILSSEPY      240
241      DDDPRWQPIPDHCLVRAEPGRLAVEPLTGVPAAHTERPLA                          280