Sequence for MER0041887

>MER0041887 - family C44 non-peptidase homologues [C44.UNW] peptidase unit: 2-245 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCGIVGYVGYRDALGVVVDALRRMEYRGYDSAGVAILDGAGTLAVERKAGRLANLEAELA       60
61       ESGAGAFAGTTGMGHTRWATHGAPTDRNAHPHRDAGGKVAVVHNGIIENFAPLRRELEDA      120
121      GVELRSDTDTEVAVHLVARAYAEGPTAGDFTASALAVLRRLEGAFTLVFVHADHPDTIIA      180
181      ARRNTPLVVGVGKGEMFIASDVTAFIEHTREAVELGQDQAVVITADSYTVTDFAGRGDGV      240
241      RTRPYTIDWDIAAAEKGGHDYFMLKEIEEQPAAVADTLIGHFTTDEAGGRIVLDEQRLAD      300
301      QELREFDKVFVVACGSSYHAGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAI      360
361      SQSGETADTLEAVRHAKEQKARVLAICNTNGAQIPRESDAVLYTRTGPEIGVASTKAFLA      420
421      QVAANYLVGLALAQARGTKYPDEVAREFQELEAMPKLVSRVLETAPQVRAIARELAHVPT      480
481      VLFLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGR      540
541      AVLHSKLLSNIREIQARGARTIVIAEEGDDTVRPFADDLIEIPSAPTLFQPLLSTVPLQI      600
601      FAAEVAQTRGYDVDKPRNLAKSVTVE                                        626