Sequence for MER0041295

>MER0041295 - family U62 unassigned peptidases [U62.UPW] peptidase unit: 1-461 (Nocardia farcinica) (Source: MEROPS) 
1        MSVQGVPPAGAVVEQALALARADETIVMVTDAHEASLRWAGNSMTTNGASVSRQWAVVSI       60
61       FRDGPRAARVGSVGSTSVDPAEVATVVRAAEAAARSAEPAKDAMPLLDSTDSVEDWAAEP      120
121      GTTGIEVFTELARGLADGFDAADRLYGFAHHQVHTTWLGTSTGLRRRFVQPTGSVEINGK      180
181      RGPRDAPSSAWVGVGTTDFTDVDVPALLSELSGRLDWAARRVELPAGRYETLLPPSAVAD      240
241      LMISLMWAMEGRGAHEGHNAFARPGGGTRIGERLTELPLTLWSDPRAEGLAYRPFVATPE      300
301      SSETLSVFDNGLLADRVDWVREGVVHALAYPRATAAEFGATPTVPGENLLLTGGSAASTA      360
361      ELVARTERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVEDGRVTAEVNNFRFNESPLDL      420
421      LRRVTEAGATEATLPREWKDWFTRAAMPPLRIPDFHMSSVSQAT                      464