Sequence for MER0041294

>MER0041294 - family U62 unassigned peptidases [U62.UPW] peptidase unit: 1-497 (Nocardia farcinica) (Source: MEROPS) 
1        MSTATSGGPRRAVDAEFRALPLAALADAALTAARAAGAEHADLRVHRLRTQSIRLRDGRV       60
61       EAVADSTDLGFAVRVIVDGTWGFASHAALTPATAAEVARRAVTVATALRALNRERVELAP      120
121      EPRYPGAEWVSAYDIDPFTVPTAEKVALLQDYSERLAAADGVDHVSAAVLQVKEQTYYAD      180
181      TAGTVLTQQRVRLHPQLEAITVDSAAGVFETMRTLAAPAGRGWEYVTGADGVWDWDAELA      240
241      RIPGWLAEKVKAPTVSPGPTDLVIDPTNLWLTIHESIGHATEYDRAIGYESAYAGTSFAT      300
301      PDKLGTLRYGTPIMHVTGDRTEPHGLATVGYDDEGVAGQRWDLVRDGVLVGYQLDRAFAP      360
361      RLGLDRSNGCSYADSAHHVPIQRMANVSLQPDPARDTSTAELIGRVEDGLYIVGDKSWSI      420
421      DMQRYNFQFTGQRFFRIRNGELAGQVRDVAYQATTTDFWGAMEAVGGPSTWQLGGAFNCG      480
481      KAQPGQVAAVSHGCPSILVRGITILNTRTEAGR                                 513