Sequence for MER0041293

>MER0041293 - prohead peptidase (bacteriophage HK97) [S78.001] peptidase unit: 20-169 ( active site residue(s): 65,116  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNTKACAVKVKAGPDAGLAEGEFIAYASVFGNKDSYGDVVQPGAFTDTLAAWAAKENPIP       60
61       LLWGHNTADPDFNLGEVVEAIEDFHGLKVHGRLDMESPKSAQVYRLLKSGRVSQMSFAYS      120
121      VIEGEWVEPVGEGKTYKDAYYSLKKLDLYEVSIVPIGANQETEILAVKAAASALRAKAGR      180
181      VLSAKNETTIRDVKTQLEEASQALDEVLAAVATDENTDEQDQTSGKEPSPGKSAQTSAGK      240
241      TTPNPVVSLASLDALAAEIECSA                                           263