Sequence for MER0041292

>MER0041292 - gamma-glutamyltransferase 1 (bacterial-type) [T03.001] peptidase unit: 39-627 ( active site residue(s): 431  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLTGCSAGDEPVAQPCTSTENGSAITAEPSAAATATTQNLALNPEIASGYRAGMTPVETG       60
61       SYAVSTANPIATEAACAVLRDGGTAADALVTAQLVLGLVEPQASGIGGGAFLLYYDAASG      120
121      GIDAYDGRETAPVAATENYLRWISDTDRTEPRPDTRASGRSIGVPGVLRMLELAHREHGK      180
181      TGWRELFDPAIALADQGFAISPRLAAQIAESAPELARDEAARAYFLQPDGTGKPAGTTLT      240
241      NPALAKTLSTIATDGADAFYTGVLAENIVAAVASDAGGRTPGLLSTADLAGYQVKKRTAL      300
301      CSAYRAHEICGMPPPSSGGSTVAATLGILENFDLAALGPQEVDRDGGTPRAEAVHLIAEA      360
361      ERLAYADRNKYVADPDFVPLPGNSAQSLIDRNYLKQRAGLIDPQRSMGTAQPGDLGPVPV      420
421      GVGPQPPEHGTSHISVVDRYGNAAAMTTTVESAFGSFHMVDGFVLNNQLTDFAADPVAPD      480
481      DAPVANRLEPGKRPRSSMAPTLVFDRAPDGGRGQLTHVTGSPGGAVIIQFVVKTLIGMLD      540
541      WGLDPQQAVSAVSFGAGNSPTTGVGGEHPAIDATDNGDHDPLVRRLRELGHDVSVAPQTS      600
601      GLSALRRAEPGWIGGADPRREGAVLGDIR                                     629