Sequence for MER0041291

>MER0041291 - rhomboid peptidase 2 ({Mycobacterium} sp.) [S54.029] peptidase unit: 42-230 ( active site residue(s): 147,199  ) (Nocardia farcinica) (Source: MEROPS) 
1        MGASFDPERIAALRARADGATTTTPSRPGRFAGVRQLWARAAVLIAGFVALLYGIEGVDS       60
61       LDGKAQLDDAGIHPRELDGLWGILWAPVLHHGWDHLLANTLPVLVLGFLVLIAGILRGLA      120
121      ATAIIWVVAGLGTWLTGGSGTVHLGASALVFGWLTFLILRGWFARNLGQIVLGLVVLACY      180
181      GSLLWGVLPGPDRISWQGHLFGAVGGVVAARTLAGRRRGAQAGPPAAARV                230