Sequence for MER0041290

>MER0041290 - At1g25290 ({Arabidopsis thaliana}) [S54.A08] peptidase unit: 68-286 ( active site residue(s): 185,231  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNDRPPTCVRHRDRATGLACTRCGRPACPECLRPAAVGQHCVDCVREGSAGVRPVRTVAG       60
61       APVARSATPLVTYGLIAVNLVFFAITAVQARSIVDNFQSPLFFRLALIPAYVADGEWLRV      120
121      IGSGFLHWGPLHLALNMFALYIIGIQLEPVLGRWRLLAVYLVALLGGSAGGMLLEPANTI      180
181      GAGASGAVYGMFGAIAVVIFRLRLNPTQILVVIGINVFLSLSLPGISLWVHLGGLLAGTL      240
241      ATLGVLFLPEWLGVRTSETARTVGWAAIAAVGVASVAAIAVAAAML                    286