Sequence for MER0041289

>MER0041289 - family S51 non-peptidase homologues [S51.UNW] peptidase unit: 52-212 ( active site residue(s): 122,167,204  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRLFLASYRFGRHAQRLARLVGGPGRVAVVPNACDAWPSAWQAAVTSDLVPLRRAGYAPE       60
61       VVDLRDHLGQPAALERRLREFPLLWVRGGNTFVLRAQFARSGADRVIPALLAEDRLAYAG      120
121      YSAGACVLTPDLHGLDVVDDPQEVVTACGVAPRWDGLGLVPYRIVPHLDSPTDPDGACRR      180
181      IAEKYRTAGVPHHALTDDEVLVVDGDEFERLG                                  212