Sequence for MER0041288

>MER0041288 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-265 ( active site residue(s): 108,223,253  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSQTKDGSFEGTGSRIAWRAWLPDGPARAAIVLVHGVAEHSGRYVHVGTRLADAGYAVYA       60
61       LDHVGHGKSAGGKANIGSLDGAADNVAGMLDIAAREHPGVPRFLLGHSMGALIVLYLATR      120
121      APIDVAGVVVSAPPLEIPVGNPLQKLLAPVLTRLTPNLGVLQLDSSSISRDPAVVAAYDA      180
181      DPLVYRGKLPARTATEILDGSLTVKRRLGKLTVPTLVLHGTADTLAAPSSADLIERGAAA      240
241      EDLTVHRYDGLYHEVFNEPEKETVFADLERWLQDHLTTQ                           279