Sequence for MER0041287

>MER0041287 - SCO7095-type peptidase [S33.010] peptidase unit: 1-255 ( active site residue(s): 97,214,243  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVDVPYIENNGVKIHFTDTGGSGRAVVLGHGFFLDQEMFAAQAAGLAPDYRVIAIDARGF       60
61       GGTEDSGEPFSYWDLARDAWAVVDALGLDRVVAGGMSQGGFTALRMALLAPPRVDGLILI      120
121      GTSAEAYTPKQKIGYREVMDAWTGSGPLAPIAKTMASVMIGGTDEDRRPWLDKWSTGDRR      180
181      RIRLAADCLINRESITELIGEITCPALLLRGISDQAFAAEDMEALAASLGGPTRFHTIPG      240
241      ATHAVNITHPREVNALLREWLAQLDGTPSQS                                   271