Sequence for MER0041286

>MER0041286 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-252 ( active site residue(s): 85,211,240  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSVNHFRTGSGEPLVLVHGIGSRWQVWEPIIPLLAERFEVIAVDLPGFGGSAPLPRTTV       60
61       DTLTDALAEFLAAEGIERPHLAGNSMGGYITLRLGARGLARSVTAYSPIGFWDTPGRIWC      120
121      QQTLGNSVVLARVLKPVMPHLLGTAAGRTALLYLVFGRPWALDRQTAMDTAQGAADAPGF      180
181      REALASFTDVEFDEIGALADIPVTIAWGNRDVLLTYATQSRRARLALPTARHRTLFGSGH      240
241      TPFYDDPDTCARVLLEQFDPGPS                                           263