Sequence for MER0041284

>MER0041284 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-346 ( active site residue(s): 151,303,334  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTADTKECAMLVTSMKTLAGVRSTEPLTAAYRAALRSRTYATASLNKPAAPVEIVPVTTV       60
61       DGARLRVHAYGPADGEVIVLIHGWSCCIEYWHPQINALADRYRVICYDQRGHGESTLGRV      120
121      APCADTLADDLATVLDATLPRGRRAVLVGHSMGGITLQAWAARYPEQVPDRAAAVVLANT      180
181      ASKDIRFETDLLPLLNKPLAVANRPLTVFGRGVRMPMVLAETLLTAPVPLPGGPMSPLVT      240
241      AVLKSRVMTRNATADQAAFALGIVRSCRPLTRGLHAAALADMDLGDAAKNLTVPTTVIAG      300
301      LHDHLLPERMNRTIVEALKSSGSLADYQVWPTGHLSNVEAADRFNAELAKIAASAYRPQA      360
361      DAV                                                               363