Sequence for MER0041283

>MER0041283 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-278 ( active site residue(s): 95,219,247  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDVQRRNRIVVTGQAGAPVVVLAHGFGCDQNLWRLVVPLLAPDFTLVLFDHVGSGGSDLS       60
61       AWNAERYGTMQGYADDVVEVCRAIDAGPVVFVGHSVAATMGVLAAAAEPELFRGLVLLAP      120
121      SPCFIDDPARGYRGGFSAADIDELLESLDANYLGWSGAAAPMIMGNPDRPELAAELESSF      180
181      CRTDPEIARVFARVTFLSDNRDDLAAVTVPTLVAQCSHDAIAPPEVGEFVHARIPGSELI      240
241      TLSATGHCPQLAAPEETAAAIATFVRKLPARAPTTATR                            278