Sequence for MER0041281

>MER0041281 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-312 ( active site residue(s): 135,260,289  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRPRFRPHARGVDFSTYAAFLPPSLRGEPLAAPEPTWWPWRGRQVHIARATRPEASARIL       60
61       AVHGAGGHAGLVWPFAALAARAGIDAAAVDLPLYGDTREPDPRGVRYRDWVDLLTDLVRA      120
121      ETDADPRPLILFGASIGGLLAYEAAARSGRVAHVLATCLLDPADPAARRAAARWSWTGAA      180
181      APTLLGALGPAARLRVPIRWLADMANMSADPAVSRACATDPRGGGIRVPLGFLADYFTFE      240
241      HTRPQHYTAAPVTLVHPAADRWTPPELSLRFLDRIAAEHRAVLLANCGHFPLEEPGVHVL      300
301      RETIEAVIAATT                                                      312