Sequence for MER0041280

>MER0041280 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-520 ( active site residue(s): 193,460,487  ) (Nocardia farcinica) (Source: MEROPS) 
1        MMRTRLFRAVSALTAVGAVGASLLCAAATAAPGPVFGDCPEGAVTPGVGVRCAVVSVPMN       60
61       HAEPDGPRIELTVSRIAASGERRGALFTNPGGPGVDALDFWAQRLSTVPAELVEHYDLLA      120
121      VQPRGLRWATPLACAVDAAAPGQVSTTDEELKRACDAAQPGYLDTITTENTARDLDAVRA      180
181      ALGLDRIDYLGTSYGTYLGAVYATLFPDRVGRMVLDSNVHPGWIWTEEFAQQQAAGKQRM      240
241      DDLFGWIAERDAEYHLGSTPLQVYRTWVRLVSAQGGGWYANLTPPPASVADLPGDLPEPL      300
301      AEIARDGVNGTVEHLVKVQNFLRTLVSGGASAQVPLIGATSVATYTRAFWPTFAEAMAAA      360
361      NADPANVARLRAIAGATATDPTGRFVFSAITCNENAVPGRPELLGAAVGTIASGGNALDA      420
421      RADLVRSGMSCGTWKPVTTPVPIDGSGLATRPLLLQSRNDALTRYEGGPAMARALGGALV      480
481      TVEGGDHGTFGRGNPAVDEAVLTYLRTGEVNATVLPEAPLPG                        522