Sequence for MER0041279

>MER0041279 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-273 ( active site residue(s): 100,224,252  ) (Nocardia farcinica) (Source: MEROPS) 
1        MATRDAVSADGTRIVYRVNGPEGARPLLLVHGWSADLTCWGAAADELARHYRVIAMDLRG       60
61       HGYSDIPDSGYDDPKNWAADVAAVLAAEAADTRAVLLGWSYGGIVVSDYLTAHGTDAVAG      120
121      VIYTGSMANIGVDVPGAEMGSALRQAIPGVFDESPGKAVRGFMAFGNANTGEGTDKGVDA      180
181      QRLFGMSLSTPPAVRKALFYRTVDNTETLRALDVPVLVLHGTADPVVPLANGRYVAETVP      240
241      TARTSFWEGAQHGLFIEDRARFVAEVREFVDGL                                 273