Sequence for MER0041278

>MER0041278 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 23-269 ( active site residue(s): 105,229,257  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPLATVNGISLNYQVKGDRAKGTEAKGSAPLVVMIMGTGSPGRVWELHQVPALLAAGYRV       60
61       CTFDNRGIAPSFEAADGITIDDLVGDTAGLIELLDEGPALVVGTSMGARVAQELALARPD      120
121      LVRKAVFMAGHGRLDQFQKTLSLGEHDLDASGITLPPKYEAAVTAVMNLSPATLADANAA      180
181      RDWLDLFEFTGGPVTPGIRAQRRMDHDFDRVQAYRGITVPCLAVGFADDRMIPAYLTREV      240
241      AEAIPGARYQEVPDAGHFGYLERPEIVNKILLDFFAA                             277