Sequence for MER0041277

>MER0041277 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-258 ( active site residue(s): 80,205,234  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSPARSSVVLFHGVTMSAAAWDDVVPHLSDHHDVFAPTALGHRGGPAVRQRPVRVRDVVD       60
61       AAERMLDDRGIEQAHLAGNSLGGWIAIELALRGRASSVCALSPAGFWNPGGHGQTAAVRK      120
121      LRRLGALTRATHRVQPLVFRSATIRRLAMRDIACHADRLTPAQALTAATDLVECAATDDL      180
181      LATDEYIPAVPDLPCPITLAWSGADAILPPEVNGRIARERLPQARFEILPGVGHVPMIDD      240
241      PELVAATILATTGAVPGPHRA                                             261