Sequence for MER0041276

>MER0041276 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-292 ( active site residue(s): 115,231,259  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIGKGGIMLRVEDQLVRHLKTSGGDIAYSAVGSGPPLLVGGWWCSHLTLNWEDPLFRAY       60
61       LTRLAERFTVIRYDQPGRGASGTGGNTLDLDGEIAVTTELIEALGLDRLALVGASSGAAV      120
121      AAGLAARMPGRVHRLVLYGAFARGADIAPEAARRAMVDAISAHWGLGSRLLADIFIPGAG      180
181      NAERERFAQFQRLSATAEQAARSLAGAYALDATDYLAALTVPTTVLHRRDDRAVPFALGV      240
241      DVARRVRRATFVELPGEDHFPWRGDAGGVADATLRGLGHPIRSHPTPPGPAALTEREREI      300
301      LRLVADGLTDAQIGERLTLSPHTVHRHIANARIKLGVRSRAAAAAAIRDR                350