Sequence for MER0041275

>MER0041275 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-256 ( active site residue(s): 100,216,244  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVKLARRLTRPGAEIAFADFGGDGSSVVLIHGAGVDHSMFDEQVPVLTQRGYRVIVWDLR       60
61       GHGQSALSPGERFTASDALEDLDALLAECGVDAPVLVGHSLGGNLAQAFARKFPQRVGGV      120
121      IVLDSTWNAGPLSALERFALRLAAPGLAVIPAGRLPRIMARASATTPEAMARTEALFTRI      180
181      PKRTFLDVWRATASFVAPEPGYRSPVPLALVRGAEDRTGNIATAMPRWADAEGLVEHVIP      240
241      GAGHMVTMDAPAETSRLLVSILDGWDQRPAASERRSR                             277