Sequence for MER0041274

>MER0041274 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-294 ( active site residue(s): 115,254,282  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSQPRILAAAAERRVTVTTDDGVALAVREYGPRDAELTVVLVHGHCLRSESWTAVRDELL       60
61       RRHPHARVLCYDHRGHGDSAAAPRHTYQLDRLARDLRAVLDTLVPVGPVVLAGHSMGGMT      120
121      VLTYAGRYPREIGTRVVGVALLATAASGIADAGFGRLLRNPVVSAFQWAVRRAPRLMQRA      180
181      KLLACKLFAPVIRTAEFGDRAVSPQVLALANAMHNETSIVTMASFLSAFMSYDRTDALPV      240
241      LSAVPTVVLCGSADLMTPPAHSVAMAAAVEYSDLVIVDGAGHSVILEEPAQVAEVLGRLL      300
301      VRAGNRSAAYSLAA                                                    314