Sequence for MER0041273

>MER0041273 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-301 ( active site residue(s): 125,249,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAGPDVRATRIHRLVRRAGVPDIAGVPGGREIELPGRGSTYVVDIPGPAGAPALILLHGT       60
61       ASTALLNWFPALEGLSERFRVILFDQRWHGRGIRSRTFRLDDCADDVVAVADALDVPRAV      120
121      CVGYSLGGAVALTTAHRHPDRVAGLALCATPYRFREKWREKAFHQAFGALADVIAPLSLR      180
181      RAEKLLHALAEVPEQQWAPGDFERWALAEFRSTSGWALTQVIAEVGRFDATPWLHTLDLP      240
241      TAVVITTRDRAIPVYRQLEMATMIPGATIHLARTGHTGCVFGADRFVPAVLAACDSVADR      300
301      L                                                                 301