Sequence for MER0041272

>MER0041272 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 6-412 ( active site residue(s): 194,357,387  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLRVMTGLPKVGGKRARRRFSRHDRVVRVTVSTDQSPCPSATGAELLPPPDGTLAIVPVG       60
61       DIRLESGAVIPDVHLGVQRWGELSPGLDNVVLVEHALTGDSHVVGPADDVHQLPGWWNGM      120
121      VGPGAPMDTDEWCVIATNVLGGCKGSTGPGSTAPDGKPWGSRFPAISIRDQVTAEAALFD      180
181      RIGIHRLAAVVGGSMGGMRVLEWMVGAPERVAAALVLAVGARATADQIGTQTTQIAAITA      240
241      DPDWQGGDYHDTGRAPTTGMGIARRIAHLTYRTEDELDHRFANHAQDGEDPFDGGRWAVQ      300
301      SYLEHQAEKLCRRFDPATYVLLTEAMNRHDVGRGRGGVAAALAATPVPCVVGGVDSDRLY      360
361      PLHTQQELADLLPGCARLEVVHSRDGHDGFLTETAAIGKLLVETMRLARAHR              412