Sequence for MER0041271

>MER0041271 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-292 ( active site residue(s): 122,250,280  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLTMTSDTSPSPASPAARASAATGAKPARKKPVERPAAMAALHIGSGDPLLLLHGFLLSP       60
61       HCWEQTATLMAAHCEVFAPALAGHWGGPEAPGRTIDIAALADAVERQLDEMGWRTCHIAG      120
121      NSLGAWVGVELARRGRARTLTLIAPAGGWNVPSLTQFRVALKFLSLVPVTRLGARMADFA      180
181      ARNRVVRRLALFPVVKNPTAVARRDAVATVTAAVNCRAMVPLILGSLRAPALADLSDLAT      240
241      PVRLLLSEYDRVIPNRVYARRFLKELPDSADRILVNRVGHVPMLEAPDRIATLIAEHVYA      300
301      SRTRLRAV                                                          308