Sequence for MER0041270

>MER0041270 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 19-568 ( active site residue(s): 232,506,535  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTGPGVAAQDVHVGRWRIALVVVAMLPLAAGCAGAVQQQTALGQLAAQADAAATPRLDW       60
61       TDCAEQQLAGYECAAARVPLDYARPDGETIELALVRQRAGDPQRRLGTLFAAAGGPGNSG      120
121      LDWARGGPMFPGEISRRFDVVTFDQRGVGASAPVRCFADAAEQERFWSTMVLPPADAEQQ      180
181      LAAERAARAYAEGCARHSGALLPHLTTVDAARDLDLLRRAVGEDRLTFTGGSYATYLGQV      240
241      YGALFGERVRALHLTSVIDPAVYGGDTRAEIAGTAAGTAEVFEEFLRLCAQGGRPECAFA      300
301      EGGERSELVGESGPGAAEKAGSSGTERPSVTLTTAAGPAEADVERLRARDAALLERLRTG      360
361      PITVGTGEQAVRVGYAEVVQAHALLLYDPRQGWPALAGLLAELDRGPHGDPAPVRQALAG      420
421      GATPLDFLDSFTAITCADATLPRDPARWPALAQETPAATPDFDDFWLYMRQPCAAWPTPE      480
481      QDARHVAGPWTLISDKPALLVNNRYDPATPLEFARRAQQELVNARLVVVEGGYGHEPGGE      540
541      CVRSLRERYLIDLQLPAPGATCTADRAPFAS                                   571