Sequence for MER0041269

>MER0041269 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 7-334 ( active site residue(s): 156,294,322  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRGRIGRGGFATAVLVGALAGAHVVRRLGQWVLHLDVPDAYVAEDFALFEADEPSTVTAT       60
61       DGVPLAVRAHGPENADVTMVFVHGFCNSMESFHFQRRDLPARWGPRVRLVFFDQRGHGRS      120
121      GTPSTDSCTVPQLGRDVAAVLAAAAPSGPVVLVGHSLGGMAVLAAAAQFPALFGSRVAAV      180
181      ALLSTSAAQVTSTGITQLLRNPVIDGFRLAVEAAPALVQAARTAGRHVITPLLHVTSFHG      240
241      PVSPALSRFTARMIDRTPVETIVKFLEAIRVHDESAALSTLAQLPVLVLGGTRDVVMPFR      300
301      NSEALARELPDSELVLLPGAAHMPHLQYPDLVNDALHRLMVRAGVFRRGRSRRDGRTGSA      360