Sequence for MER0041268

>MER0041268 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-286 ( active site residue(s): 107,231,263  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNRNDLGHSLSQHTLDQIARANDSGNTPVVFIHGLWLLARSWDRWAELFAAAGYAPVTAG       60
61       WPDDPDTVEAARAHPEVFAGKTVGQVADHFAAVIERLDRTPAVVGHSFGGLLAQIVAGRG      120
121      LSAATVAIDAAPFRGVLPLPISSLRAAAPVLGNPANRHRAVPLTYEQFRYAFANAVDEAE      180
181      AKELFENFAVPAPGAPLFQAAAANLNPWSETKVDTHNPDRGPLLIVSGERDTTVPHAISK      240
241      AAYDKQRANPGITEFVEIPGRGHSLTIDSGWPTVAETALAFIRRFA                    286