Sequence for MER0041266

>MER0041266 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 28-315 ( active site residue(s): 125,264,291  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSTPGSPTSRSAAAMTATRAESPFASGTVVRRGDVELAVFQCGDPAAPPLLLIHGWPDT       60
61       HLLWNEVAARLAGRFRVIAFDNRGAGASTVPAEVAAYRIEELAADVLAVLDAVVPDERVH      120
121      ILGHDWGSVIGWEVVSTPGAAERIASFTSLSGPNLDFLGAYLRGPVSARRLRGALEQGVA      180
181      SAYTVAFQIPGLPVPVMRLLSRRWPRFLAFFDGLDAAAVPAAPTLPADMINNLKLYRANI      240
241      RARLRHPRPRPVEVPVQVLIATGDRAVRPVVHEEAERWVRDLTRTEIRARHWSPLSHPDE      300
301      VAGRTADYIEAITARAGTGTARPGQSEPS                                     329