Sequence for MER0041265

>MER0041265 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 11-227 ( active site residue(s): 80,168,224  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLYDEGGAGAPILLLHGLMGSARTWAGHLDWLRGHGHVYTFDAAGHGRPAPPELTTEAFV       60
61       ADLAEATAGIGEPMAVIGHSMGGLHGWVFAAHHPERVRALVVEDIAPDFTGRTAADWAAM      120
121      IESWPQPFPDADAVLSYFGPVAGRYFLNSFEHGPQGYRLHGSVATFRDISEEWGGRSFWA      180
181      EWRAVRVPALLIEGEHTITPPGQMREMAAVNPHAEYVRVAGAGHLVHDEQPRRYRAEVAR      240
241      FLDRVLGAP                                                         249