Sequence for MER0041264

>MER0041264 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-282 ( active site residue(s): 112,243,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSNANYLLEPQTLRLRGSGGLELAADLFGPEDGPLVIFLHGGGQTRHSWKRTGAALAAGG       60
61       LRVVTLDARGHGDSQWAPDRDYSRAVMVADLLAVLDQLGATPERGAVVVGASMGGITGLL      120
121      ATAQPGGAAIRALVLVDIVTRPQPEGVERVMTFLGKHRDGFDTVEQAADAVAAYLPHRPR      180
181      PKNHDGLLRNLRHRDGRWYWHWDPDMIDGRTADADTDSMAALLEPAARALTIPVLLVRGR      240
241      MSDVVSEEAVAEFLEQVPHAQVVEIGNAAHTAASDDNDAFTDAVAEFVLAAAR             293