Sequence for MER0041263

>MER0041263 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 3-280 ( active site residue(s): 102,234,261  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSFLDNTVRETTVDGVRVAYVTAGRGEPLVLLHGWPEDHRAWSHQLAPLAAVRRVIAPD       60
61       LPGWGASDRDVRLSHDYDSEVDRLARLLDALGLDRIDLACHDYGGFLGLGFLHRYPHRVR      120
121      RFALLNSRAHGTFTWPYRLLFGAFTTLASHRATRRLLTVRAMYPLHRWGLRGYVRNGSFS      180
181      PGLLDDYLSMLRTPEGLRWYAHFWAGYRVRVRPELAAGLAAVDCPTTVIWGRRDPAIPLR      240
241      TARELASRIPGAHLVLLDADHFVMEQRPAEVTEALLAWLDRPVENTAAAN                290