Sequence for MER0041262

>MER0041262 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 10-303 ( active site residue(s): 116,263,291  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSPTPPDPSTVRYDGPWTHRDVHANGIRFHVVEAAPERTDAPLVVLLHGFADFWWSWRHQ       60
61       LTGLADLGYRAVAVDLRGYGDSDKPPRGYDGWTLAGDVAGLIRALGHTEAVLVGHAEGGL      120
121      VCWATAVLHPRLVRAIALVSSPHPAALKAAVLTDARQRRAWLPAFLRCQLPRLPEHRLTT      180
181      ADGFEVERMLRRRVGAQWAGTSEFVDTARRMRTAIRIPGAAHCALEYQRWAFRSQWRPDG      240
241      RRFMATMRDPIDIPVLSLRGEHDNYLLRPTFHRGHRWAPHRRLVTVPEAGHFAHQENPDV      300
301      VTTELAKFLA                                                        310