Sequence for MER0041261

>MER0041261 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 14-280 ( active site residue(s): 108,240,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTPVDTLAVPELRELTTEHGVLRYRECGDGPPLLLLHGSGPGVTGWRNFGGNVPVFAEH       60
61       YRTLVLEFPGFGVSDDFGAVHPMLSAQQAVRAFLDGLGLEQVRIIGNSMGGFVATDFAIA      120
121      APERVERLVTIGGIGTPLFSAQPGEGIIRLGEFVDNPTRERLIAWLRSMVFDQSLVTEEL      180
181      IEQRWQQATDPATLENSRRMYGSAALARMAEAARAADTTPGWANLGRITAPVLVTWGRDD      240
241      RVSPVDMALLPMRTLRNGEVHIFPNCGHWVMIEQKRAWEAVVLAFLGR                  288