Sequence for MER0041260

>MER0041260 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 11-286 ( active site residue(s): 109,238,267  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQITFVPDATLYPFASRWFDSSVGRVHYIDEGAGPTILFCHGAPAWSFLYRRIVRALRDR       60
61       FRCVAVDHLGFGLSERPTGFGYTVAEHTAVLGELIDHLRLEDFVVMGHDWGGPIGLGAAG      120
121      ARADRVRGVVLGNTALWPIDALANRVFSVVMSSRPLQRRILEHNFLIDRVLLAELRGVLT      180
181      KAEADHYRGVQPTPAARRGLAVMPGQIRAARPLLEELARKVPERLGDKPTLAVWGMRDVV      240
241      FRPSACLPRVRAMFGDLEVVELSGARHFVQEHEPDAIAVAITERFS                    286