Sequence for MER0041259

>MER0041259 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-269 ( active site residue(s): 91,236,257  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRAYSVDGIRYDIIGDGTPLVLVHGGSGRRQWFDPMTPLLERDARMLRVDLPGHGDSVPT       60
61       PGHYRLEESAAALHRVLDHAGWERCVVFGHSHGAHVAAVLAADHPDRVAGLVIGDAPFDR      120
121      ERMRAHHRATAPMNRAWRALTGAARPQAHTLAGFLALEIAGPGSPSIEDVFGREHPYVRE      180
181      MVASLRHHDGDFLDAVLDRFDDTYHRLDDALLRAVTCPVVLLAADPAAGGLVGDADIAYL      240
241      TDRAAGARVHRLSGVGHGLQLQDPRQVAEALRDHLRPQR                           279