Sequence for MER0041257

>MER0041257 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-288 ( active site residue(s): 104,236,264  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTHSSALGRQREIDLPGGRIRYYETGSGSPVVFVHGLLVNANLWRKVVPDIAAAGYRCLA       60
61       PDWPLGAHSIPVPEADLSPAGLADLIAAFLDRLDLTDVTLVANDTGGAITQVLLARQRAR      120
121      IARVVLASVDCYERFLPPPFKLLTPLARIPGSLRPATELLRIRALHPLPIALGWVVKRPV      180
181      PPEVVDTYLLPSRRSGAIRHDLRRFLAGARNSYTLEAARHFGEIDLPVLLVWAREDKLFP      240
241      VRLAERLAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQHAAT                  288